CDS

Accession Number TCMCG028C17335
gbkey CDS
Protein Id KAF6167290.1
Location complement(join(401439..401536,401622..401793))
Organism Kingdonia uniflora
locus_tag GIB67_043151

Protein

Length 89aa
Molecule type protein
Topology linear
Data_file_division PLN
dblink BioProject:PRJNA587615, BioSample:SAMN13195877
db_source JACGCM010000760.1
Definition hypothetical protein GIB67_043151 [Kingdonia uniflora]
Locus_tag GIB67_043151

EGGNOG-MAPPER Annotation

COG_category A
Description The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins. Some of these proteins have been shown both in vivo and in vitro to have ubiquitin E3 ligase activity.
KEGG_TC -
KEGG_Module -
KEGG_Reaction -
KEGG_rclass -
BRITE -
KEGG_ko -
EC -
KEGG_Pathway -
GOs GO:0000209        [VIEW IN EMBL-EBI]
GO:0000323        [VIEW IN EMBL-EBI]
GO:0002376        [VIEW IN EMBL-EBI]
GO:0002495        [VIEW IN EMBL-EBI]
GO:0002504        [VIEW IN EMBL-EBI]
GO:0003674        [VIEW IN EMBL-EBI]
GO:0003824        [VIEW IN EMBL-EBI]
GO:0004842        [VIEW IN EMBL-EBI]
GO:0005102        [VIEW IN EMBL-EBI]
GO:0005488        [VIEW IN EMBL-EBI]
GO:0005515        [VIEW IN EMBL-EBI]
GO:0005575        [VIEW IN EMBL-EBI]
GO:0005622        [VIEW IN EMBL-EBI]
GO:0005623        [VIEW IN EMBL-EBI]
GO:0005737        [VIEW IN EMBL-EBI]
GO:0005764        [VIEW IN EMBL-EBI]
GO:0005768        [VIEW IN EMBL-EBI]
GO:0005773        [VIEW IN EMBL-EBI]
GO:0006464        [VIEW IN EMBL-EBI]
GO:0006807        [VIEW IN EMBL-EBI]
GO:0008150        [VIEW IN EMBL-EBI]
GO:0008152        [VIEW IN EMBL-EBI]
GO:0009889        [VIEW IN EMBL-EBI]
GO:0009890        [VIEW IN EMBL-EBI]
GO:0009892        [VIEW IN EMBL-EBI]
GO:0009987        [VIEW IN EMBL-EBI]
GO:0010556        [VIEW IN EMBL-EBI]
GO:0010558        [VIEW IN EMBL-EBI]
GO:0010605        [VIEW IN EMBL-EBI]
GO:0012505        [VIEW IN EMBL-EBI]
GO:0016567        [VIEW IN EMBL-EBI]
GO:0016740        [VIEW IN EMBL-EBI]
GO:0019222        [VIEW IN EMBL-EBI]
GO:0019538        [VIEW IN EMBL-EBI]
GO:0019787        [VIEW IN EMBL-EBI]
GO:0019882        [VIEW IN EMBL-EBI]
GO:0031410        [VIEW IN EMBL-EBI]
GO:0031982        [VIEW IN EMBL-EBI]
GO:0032446        [VIEW IN EMBL-EBI]
GO:0036211        [VIEW IN EMBL-EBI]
GO:0042287        [VIEW IN EMBL-EBI]
GO:0042289        [VIEW IN EMBL-EBI]
GO:0043170        [VIEW IN EMBL-EBI]
GO:0043226        [VIEW IN EMBL-EBI]
GO:0043227        [VIEW IN EMBL-EBI]
GO:0043229        [VIEW IN EMBL-EBI]
GO:0043231        [VIEW IN EMBL-EBI]
GO:0043412        [VIEW IN EMBL-EBI]
GO:0044237        [VIEW IN EMBL-EBI]
GO:0044238        [VIEW IN EMBL-EBI]
GO:0044260        [VIEW IN EMBL-EBI]
GO:0044267        [VIEW IN EMBL-EBI]
GO:0044424        [VIEW IN EMBL-EBI]
GO:0044444        [VIEW IN EMBL-EBI]
GO:0044464        [VIEW IN EMBL-EBI]
GO:0045346        [VIEW IN EMBL-EBI]
GO:0045347        [VIEW IN EMBL-EBI]
GO:0048002        [VIEW IN EMBL-EBI]
GO:0048519        [VIEW IN EMBL-EBI]
GO:0050789        [VIEW IN EMBL-EBI]
GO:0060255        [VIEW IN EMBL-EBI]
GO:0061630        [VIEW IN EMBL-EBI]
GO:0061659        [VIEW IN EMBL-EBI]
GO:0065007        [VIEW IN EMBL-EBI]
GO:0070647        [VIEW IN EMBL-EBI]
GO:0071704        [VIEW IN EMBL-EBI]
GO:0097708        [VIEW IN EMBL-EBI]
GO:0140096        [VIEW IN EMBL-EBI]
GO:1901564        [VIEW IN EMBL-EBI]

Sequence

CDS:  
ATGGAAGGAGAATTACAGCTAGAGACACCATCAGAGCAACAGATTCCAAGTGATTCTGATCCATTATTAGAGAACCAAACAAATTCGAGTGAGATAGTAATAAAAGATGAAGAAATCGAAGCTTCATCGGTTGTGTGTTGTCGCATTTGCCTTGAAAGTGATTGTGATCAAGGTGATGAATTGATATCTCCATGTATGTGTAAAGGTACCCAACAGTTTGTTCATCGGTCTTGCCTCGACCATTGGCGATCCATTAAGGTAAAAAATTGA
Protein:  
MEGELQLETPSEQQIPSDSDPLLENQTNSSEIVIKDEEIEASSVVCCRICLESDCDQGDELISPCMCKGTQQFVHRSCLDHWRSIKVKN